CLUSTAL W (1.74) multiple sequence alignment


AT1G14440.1 MEIASQEDHDMPIPLNTTFGG-GGSHGHMIHHHDHHAANSAPPTHNNNNTTQPPPMPLHG
AT2G02540.1 MEIASQED---PIPINTSYGNSGGGHGNMNHHHH---ANSAPSSLN-ITTSNPLLVSSNS
AT4G24660.1 -----------------------------MNFEDQEED-------MEMSGVNPPCGYDSL
AT5G65410.1 ------------MEFEDNNNNNDEEQEEDMNLHEEEEDDDAVYDSPPLSRVLPKASTESH
AT1G74660.1 --------------------------------------------MMKKRQMVIKQRSRNS
AT1G75240.1 MDMRSHEM----IERRREDNGNNNGGVVISNIISTNIDDN---CNGNNNNTRVSCNSQTL
AT1G69600.1 -------------------------------------MDLSSKPQQQLLNSLPIAGELTV
AT5G60480.1 ------------------------------------------------------------
AT3G28920.1 -----------------------MLEVR-----SMDMTPKSPEPESETPTRIQPAKPISF
AT5G39760.1 -----------------------MMDMTPTITTTTTPTPKSPEPESETPTRIQPAKPISF
AT5G15210.1 ------------------------MDVIAT-TTTIVSDLDSRQPEIEAPIRIQPAKPISF
AT2G18350.1 MEVREKKD----EKMEMTRRKSSALDHHRLPPYTYSQTANKEKPTTKRNGSDPDPDPDLD
AT3G50890.1 ----------------------MELGGKCNAITTTTMISTEVKPHTDPEPEAKPESDPSM
AT1G14687.1 ------------------------------------------------------------
AT5G42780.1 ------------------------MDEIKPKKEENSKRRRNVKPICRETGDHVHYLPTCK


AT1G14440.1 NGHGNNYDHHHHQDPHHVGYNAIIKKP------MIKYKECLKNHAAAMGGNATDGCGEFM
AT2G02540.1 NGLGKNHDHSHH---HHVGYNIMVTNIKKEKPVVIKYKECLKNHAATMGGNAIDGCGEFM
AT4G24660.1 SGEGATSSGGGG----------VGRSK--GVGAKIRYRECLKNHAVNIGGHAVDGCCEFM
AT5G65410.1 ETTGTTSTGGGGG--------FMVVHG--GGGSRFRFRECLKNQAVNIGGHAVDGCGEFM
AT1G74660.1 NTSSSWTTTSSS-----------SSS---SEISNVRYVECQKNHAANIGGYAVDGCREFM
AT1G75240.1 DHHQSKSPSSFS-----------ISA---AAKPTVRYRECLKNHAASVGGSVHDGCGEFM
AT1G69600.1 TGE-----------------------------MGVCYKECLKNHAANLGGHALDGCGEFM
AT5G60480.1 --------------------------------MVVLYNECLKNHAVSLGGHALDGCGEFT
AT3G28920.1 SNGIIKRHHHHH-----------HNN------NKVTYKECLKNHAAAIGGHALDGCGEFM
AT5G39760.1 SNGIIKRHHHHH-----------HP-------LLFTYKECLKNHAAALGGHALDGCGEFM
AT5G15210.1 SNG--KRCHHHH-----------LASE---AVAVATYKECLKNHAAGIGGHALDGCGEFM
AT2G18350.1 TNPISISHAPRS-----------YARPQTTSPGKARYRECQKNHAASSGGHVVDGCGEFM
AT3G50890.1 ALFPIKKENQKP------------KTR---VDQGAKYRECQKNHAASTGGHVVDGCCEFM
AT1G14687.1 ------------------------------MQSTCVYRECMRNHAAKLGSYAIDGCREYS
AT5G42780.1 TKPKPTRTHHAPP---------PILDSIFKVTHKPHYYECRKNHAADIGTTAYDGCGEFV
: ** :*:*. * . *** *:

AT1G14440.1 PSGEDGSIE--ALTCSACNCHRNFHRKEVEGELAATAMSPY---HQHPP-----------
AT2G02540.1 PSGEEGSIE--ALTCSVCNCHRNFHRRETEGE-EKTFFSPYLNHHQPPPQ----------
AT4G24660.1 PSGEDGTLD--ALKCAACGCHRNFHRKETESIGGRAHRVPT--YYNRPPQP--------H
AT5G65410.1 PAGIEGTID--ALKCAACGCHRNFHRKELP----YFHHAPP--QHQPPPP----------
AT1G74660.1 AAGVEGTVD--ALRCAACGCHRNFHRKEVDTEV-VCEYSPP--NA---------------
AT1G75240.1 PSGEEGTIE--ALRCAACDCHRNFHRKEMDGVG-SSDLISH--HRHHHYHHNQYGGGGGR
AT1G69600.1 PSPTATSTDPSSLRCAACGCHRNFHRRDPSENL-NFLTAPP--I---SS-----------
AT5G60480.1 PKSTTILTDPPSLRCDACGCHRNFHRRSPSD---GF--S---------------------
AT3G28920.1 PSPSSTPSDPTSLKCAACGCHRNFHRRETD----DSSAVPP--PSLLPSST--------T
AT5G39760.1 PSPSSISSDPTSLKCAACGCHRNFHRRDPDNNN-DSSQIPP--P---PS-----------
AT5G15210.1 PSPSFNSNDPASLTCAACGCHRNFHRREED--P-SSLSAIV--P----------------
AT2G18350.1 SSGEEGTVE--SLLCAACDCHRSFHRKEIDGLFVVNFNSFG-------------------
AT3G50890.1 AGGEEGTLG--ALKCAACNCHRSFHRKEVYGHR-NSKQDHQLMIT---------------
AT1G14687.1 ---QPSTGD---L-CVACGCHRSYHRRIDV------ISSPQ-------------------
AT5G42780.1 SS--TGEED--SLNCAACGCHRNFHREELIPE--NGGVTET-------------------
* * .*.***.:**.

AT1G14440.1 --HRKLMLNHQKIRSAMPHQMIMPIGVSNYR--YMHNNSESEDFMEEDGVTTASRSLPNL
AT2G02540.1 --QRKLMFHHKMIKSPLPQQMIMPIGVT-----TAGSNSESEDLMEEEGGGSLTFRQPPP
AT4G24660.1 QPPGYLHLTSPAAPYRPPAASG-----------------DEEDTSNPSSSGG--------
AT5G65410.1 -PPGFYRLPAPVS-YRPPPSQAPPLQLA-LPPPQRERSEDPMETSSAEAGGG--------
AT1G74660.1 ------------------------------------------------------------
AT1G75240.1 RPPPPNMMLNPLMLPPPPNYQPIHHHKYGMSPPGGGGMVTPMSVAYGGGGGGAESSSEDL
AT1G69600.1 -PSGTESPPSRHVSSPVPCSYYT--SAPP----HHVILSLSSGFPGPSDQ----------
AT5G60480.1 ----------QHRSPPSPLQLQP--LAPV----PNLLLSLSSGFFGPSDQE---------
AT3G28920.1 TAAIEYQPHHRHHPPPPLAPPLP--RSPN----SSSPPPISSSYMLLALSG----NNKTA
AT5G39760.1 -TAVEYQPHHRHHPPPPPPPPPP--RSPN----SASPPPISSSYMLLSLSGTNNNNNNLA
AT5G15210.1 --AIEFRPHNRHQLPPPPPPHLAGIRSPDDDD-SASPPPISSSYMLLALSG---------
AT2G18350.1 --HSQRPLGSRHVSPIMMSFGGGGGCAAESS--TEDLNKFHQSFSGYGVDQ---------
AT3G50890.1 --PAFYSSNSSYKPRVMHPTGEIGRRTSS----SSEDMKKILSHRNQNVDG---------
AT1G14687.1 --INHTRFPFTSLRRVKQLARLKWKTAEER---NEEEEDDTEETSTEEKMT---------
AT5G42780.1 -VLEVLKISSCQFRRIFCSPYGGGKSEGKKK--KKEKESYGGDPIIKDRFGG--------


AT1G14440.1 P---------------------YNQKKRFRTKFTPEQKEKMLSFAEKVGWKIQ--RQEDC
AT2G02540.1 PPSPYSYG--------------HNQKKRFRTKFTQEQKEKMISFAERVGWKIQ--RQEES
AT4G24660.1 ------------------------TTKRFRTKFTAEQKEKMLAFAERLGWRIQ--KHDDV
AT5G65410.1 ------------------------IRKRHRTKFTAEQKERMLALAERIGWRIQ--RQDDE
AT1G74660.1 ------------------------------------------------------------
AT1G75240.1 NLYGQSSGEGAGAAAGQMAFSMSSSKKRFRTKFTTDQKERMMDFAEKLGWRMN--KQDEE
AT1G69600.1 ---DPTVVRSEN-------SSRGAMRKRTRTKFTPEQKIKMRAFAEKAGWKIN--GCDEK
AT5G60480.1 -VKNKFTVERDV-------RKTAMIKKHKRTKFTAEQKVKMRGFAERAGWKIN--GWDEK
AT3G28920.1 PFSDLNFAAAAN-----HLSATPGSRKRFRTKFSSNQKEKMHEFADRIGWKIQ--KRDED
AT5G39760.1 SFSDLNFSAGNNHHH-HHQHTLHGSRKRFRTKFSQFQKEKMHEFAERVGWKMQ--KRDED
AT5G15210.1 ------GRGGAN-------TAVPMSRKRFRTKFSQYQKEKMFEFSERVGWRMP--KADDV
AT2G18350.1 -------------------FHHYQPKKRFRTKFNEEQKEKMMEFAEKIGWRMT--KLEDD
AT3G50890.1 --------KS-------LMMMMMRKKKRVRTKINEEQKEKMKEFAERLGWRMQ--KKDEE
AT1G14687.1 ------------------------VQRRRKSKFTAEQREAMKDYAAKLGWTLKDKRALRE
AT5G42780.1 ------------------AEEEEGIVKRLKTKFTAEQTEKMRDYAEKLRWKVR--PERQE


AT1G14440.1 VVQRFCEEIGVKRRVLKVWMHNNKIHFSKKNNINLEDNDNEKINN--------------L
AT2G02540.1 VVQQLCQEIGIRRRVLKVWMHNNKQNLSKKSNNVSNNVDLSAGNN--------------D
AT4G24660.1 AVEQFCAETGVRRQVLKIWMHNNKNSLGKKP-----------------------------
AT5G65410.1 VIQRFCQETGVPRQVLKVWLHNNKHTLGKSPSPLHHHQAPPPPPP--------------Q
AT1G74660.1 ------------------------------------------------------------
AT1G75240.1 ELKRFCGEIGVKRQVFKVWMHNNKNNAKKPPTPTTTL-----------------------
AT1G69600.1 SVREFCNEVGIERGVLKVWMHNNKYSLLNGKIREIEHGLCLNTHS-------------ND
AT5G60480.1 WVREFCSEVGIERKVLKVWIHNNKY-FNNGRSRDTTSSMSLNLKL---------------
AT3G28920.1 EVRDFCREIGVDKGVLKVWMHNNKNSFKFSGGGATTVQRNDNGIG-------GE-NSNDD
AT5G39760.1 DVRDFCRQIGVDKSVLKVWMHNNKNTFNRRDIAGNEIRQIDNGGGNHTPILAGEINNHNN
AT5G15210.1 VVKEFCREIGVDKSVFKVWMHNNKISG-RSGARRANGGVVVGGVG--------------D
AT2G18350.1 EVNRFCREIKVKRQVFKVWMHNNKQAAKKKDL----------------------------
AT3G50890.1 EIDKFCRMVNLRRQVFKVWMHNNKQAMKRNNSNISE------------------------
AT1G14687.1 EIRVFCEGIGVTRYHFKTWVNNNKKFYH--------------------------------
AT5G42780.1 EVEEFCVEIGVNRKNFRIWMNNHKDKIIIDE-----------------------------


AT1G14440.1 NNVDLSGNNDMTKIVP----------------------------
AT2G02540.1 ITENLASTNP----------------------------------
AT4G24660.1 --------------------------------------------
AT5G65410.1 SSFHHEQDQP----------------------------------
AT1G74660.1 --------------------------------------------
AT1G75240.1 --------------------------------------------
AT1G69600.1 GDGSSSS-------------------------------------
AT5G60480.1 --------------------------------------------
AT3G28920.1 GVRGLANDG--------DGGGGRFESDSGGADGGGNVNASSSSS
AT5G39760.1 GHHGVGGGGELHQSVSSGGGGGGFDSDSGGANGG-NVNGSSSS-
AT5G15210.1 SRQSVVPTN------------GSFSST-----------------
AT2G18350.1 --------------------------------------------
AT3G50890.1 --------------------------------------------
AT1G14687.1 --------------------------------------------
AT5G42780.1 --------------------------------------------